FAM36A antibody (70R-4394)

Rabbit polyclonal FAM36A antibody raised against the middle region of FAM36A

Synonyms Polyclonal FAM36A antibody, Anti-FAM36A antibody, FLJ43269 antibody, FAM-36, Family With Sequence Similarity 36 Member A antibody, FAM-36 antibody, FAM 36, FAM36, FAM 36 antibody
Specificity FAM36A antibody was raised against the middle region of FAM36A
Cross Reactivity Human
Applications WB
Immunogen FAM36A antibody was raised using the middle region of FAM36A corresponding to a region with amino acids LGCWFHCRYNYAKQRIQERIAREEIKKKILYEGTHLDPERKHNGSSSN
Assay Information FAM36A Blocking Peptide, catalog no. 33R-4967, is also available for use as a blocking control in assays to test for specificity of this FAM36A antibody


Western Blot analysis using FAM36A antibody (70R-4394)

FAM36A antibody (70R-4394) used at 1 ug/ml to detect target protein.


Host Rabbit
Method of Purification Affinity purified
Molecular Weight 13 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of FAM36A antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance FAM36A is a multi-pass membrane protein. It belongs to the FAM36 family. The exact function of FAM36A remains unknown.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Western Blot analysis using FAM36A antibody (70R-4394) | FAM36A antibody (70R-4394) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
View Our Distributors