FAM38B antibody (70R-6676)

Rabbit polyclonal FAM38B antibody raised against the middle region of FAM38B

Synonyms Polyclonal FAM38B antibody, Anti-FAM38B antibody, FAM-38 antibody, FLJ23403 antibody, FAM-38, FLJ23144 antibody, HsT748 antibody, Family With Sequence Similarity 38 Member B antibody, FAM 38 antibody, FAM 38, FAM38
Specificity FAM38B antibody was raised against the middle region of FAM38B
Cross Reactivity Human,Mouse,Rat
Applications WB
Immunogen FAM38B antibody was raised using the middle region of FAM38B corresponding to a region with amino acids AGNSTESSKTPVTIEKIYPYYVKAPSDSNSKPIKQLLSENNFMDITIILS
Assay Information FAM38B Blocking Peptide, catalog no. 33R-1212, is also available for use as a blocking control in assays to test for specificity of this FAM38B antibody

Images

Western Blot analysis using FAM38B antibody (70R-6676)

FAM38B antibody (70R-6676) used at 1 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 63 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of FAM38B antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance The exact function of FAM38B remains unknown.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using FAM38B antibody (70R-6676) | FAM38B antibody (70R-6676) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
OR
Shipping
View Our Distributors