FAM3D antibody (70R-4572)

Rabbit polyclonal FAM3D antibody raised against the middle region of FAM3D

Synonyms Polyclonal FAM3D antibody, Anti-FAM3D antibody, FAM-3 antibody, FAM 3, FAM 3 antibody, FAM3, FAM-3, Family With Sequence Similarity 3 Member D antibody, EF7 antibody, OIT1 antibody
Specificity FAM3D antibody was raised against the middle region of FAM3D
Cross Reactivity Human
Applications WB
Immunogen FAM3D antibody was raised using the middle region of FAM3D corresponding to a region with amino acids LVASYDDPGTKMNDESRKLFSDLGSSYAKQLGFRDSWVFIGAKDLRGKSP
Assay Information FAM3D Blocking Peptide, catalog no. 33R-5499, is also available for use as a blocking control in assays to test for specificity of this FAM3D antibody


Western Blot analysis using FAM3D antibody (70R-4572)

FAM3D antibody (70R-4572) used at 1 ug/ml to detect target protein.


Host Rabbit
Method of Purification Affinity purified
Molecular Weight 25 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of FAM3D antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance The function of FAM3 protein is not widely studied, and is yet to be elucidated fully.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Western Blot analysis using FAM3D antibody (70R-4572) | FAM3D antibody (70R-4572) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
View Our Distributors