FAM50B antibody (70R-3889)

Rabbit polyclonal FAM50B antibody raised against the N terminal of FAM50B

Synonyms Polyclonal FAM50B antibody, Anti-FAM50B antibody, X5L antibody, FAM-50, FAM 50 antibody, D6S2654E antibody, FAM50, FAM 50, Family With Sequence Similarity 50 Member B antibody, FAM-50 antibody
Specificity FAM50B antibody was raised against the N terminal of FAM50B
Cross Reactivity Human
Applications WB
Immunogen FAM50B antibody was raised using the N terminal of FAM50B corresponding to a region with amino acids EQRRERKRKISCLSFALDDLDDQADAAEARRAGNLGKNPDVDTSFLPDRD
Assay Information FAM50B Blocking Peptide, catalog no. 33R-2677, is also available for use as a blocking control in assays to test for specificity of this FAM50B antibody


Western Blot analysis using FAM50B antibody (70R-3889)

FAM50B antibody (70R-3889) used at 1 ug/ml to detect target protein.


Host Rabbit
Method of Purification Affinity purified
Molecular Weight 39 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of FAM50B antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance FAM50B may be involved in growth regulation.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Western Blot analysis using FAM50B antibody (70R-3889) | FAM50B antibody (70R-3889) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
View Our Distributors