FAM62C antibody (70R-6914)

Rabbit polyclonal FAM62C antibody

Synonyms Polyclonal FAM62C antibody, Anti-FAM62C antibody, FAM 62, C2 Domain Containing Member C antibody, Family With Sequence Similarity 62 antibody, FAM62, CHR3SYT antibody, FAM 62 antibody, FAM-62 antibody, FAM-62
Cross Reactivity Human,Mouse,Rat
Applications WB
Immunogen FAM62C antibody was raised using a synthetic peptide corresponding to a region with amino acids RNRRGKLGRLAAAFEFLDNEREFISRELRGQHLPAWIHFPDVERVEWANK
Assay Information FAM62C Blocking Peptide, catalog no. 33R-8085, is also available for use as a blocking control in assays to test for specificity of this FAM62C antibody

Images

Western Blot analysis using FAM62C antibody (70R-6914)

FAM62C antibody (70R-6914) used at 1 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 100 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of FAM62C antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance FAM62C belongs to the extended synaptotagmin family. It is a single-pass membrane protein, and contains 3 C2 domains. FAM62C may play a role as calcium-regulated intrinsic membrane protein.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using FAM62C antibody (70R-6914) | FAM62C antibody (70R-6914) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
OR
Shipping
View Our Distributors