FAM70A antibody (70R-6882)

Rabbit polyclonal FAM70A antibody raised against the N terminal of FAM70A

Synonyms Polyclonal FAM70A antibody, Anti-FAM70A antibody, FLJ20716 antibody, Family With Sequence Similarity 70 Member A antibody, FAM-70, FAM70, FAM 70 antibody, FAM 70, FAM-70 antibody
Specificity FAM70A antibody was raised against the N terminal of FAM70A
Cross Reactivity Human,Mouse,Rat
Applications WB
Immunogen FAM70A antibody was raised using the N terminal of FAM70A corresponding to a region with amino acids IVDGVFAARHIDLKPLYANRCHYVPKTSQKEAEEVISSSTKNSPSTRVMR
Assay Information FAM70A Blocking Peptide, catalog no. 33R-4195, is also available for use as a blocking control in assays to test for specificity of this FAM70A antibody

Images

Western Blot analysis using FAM70A antibody (70R-6882)

FAM70A antibody (70R-6882) used at 1 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 38 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of FAM70A antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance The function of FAM70A protein has not been widely studied, and is yet to be fully elucidated.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using FAM70A antibody (70R-6882) | FAM70A antibody (70R-6882) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
OR
Shipping
View Our Distributors