FAM71D antibody (70R-4980)

Rabbit polyclonal FAM71D antibody raised against the middle region of FAM71D

Synonyms Polyclonal FAM71D antibody, Anti-FAM71D antibody, FAM-71, FAM71, FAM 71, Family With Sequence Similarity 71 Member D antibody, C14orf54 antibody, FAM-71 antibody, FLJ36130 antibody, FAM 71 antibody
Specificity FAM71D antibody was raised against the middle region of FAM71D
Cross Reactivity Human
Applications WB
Immunogen FAM71D antibody was raised using the middle region of FAM71D corresponding to a region with amino acids VTVVFENNDLIRAKQEEKEKLKNILKPGCLQDTKSKSELKESSKHVTISN
Assay Information FAM71D Blocking Peptide, catalog no. 33R-9860, is also available for use as a blocking control in assays to test for specificity of this FAM71D antibody


Western Blot analysis using FAM71D antibody (70R-4980)

FAM71D antibody (70R-4980) used at 1 ug/ml to detect target protein.


Host Rabbit
Method of Purification Affinity purified
Molecular Weight 46 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of FAM71D antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance The function of FAM71 protein is not widely studied, and is yet to be elucidated fully.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Western Blot analysis using FAM71D antibody (70R-4980) | FAM71D antibody (70R-4980) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
View Our Distributors