FAM76A antibody (70R-3780)

Rabbit polyclonal FAM76A antibody raised against the middle region of FAM76A

Synonyms Polyclonal FAM76A antibody, Anti-FAM76A antibody, FAM76, FAM-76, FAM 76, FAM 76 antibody, FAM-76 antibody, RP3-426I6.1 antibody, MGC34648 antibody, Family With Sequence Similarity 76 Member A antibody
Specificity FAM76A antibody was raised against the middle region of FAM76A
Cross Reactivity Human,Mouse,Rat
Applications WB
Immunogen FAM76A antibody was raised using the middle region of FAM76A corresponding to a region with amino acids QCAFDRKDDRKKVDGKLLCWLCTLSYKRVLQKTKEQRKHLSSSSRAGHQE
Assay Information FAM76A Blocking Peptide, catalog no. 33R-7485, is also available for use as a blocking control in assays to test for specificity of this FAM76A antibody


Western Blot analysis using FAM76A antibody (70R-3780)

FAM76A antibody (70R-3780) used at 1 ug/ml to detect target protein.


Host Rabbit
Method of Purification Affinity purified
Molecular Weight 35 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of FAM76A antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance The specific function of FAM76A is not yet known.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Western Blot analysis using FAM76A antibody (70R-3780) | FAM76A antibody (70R-3780) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
View Our Distributors