FAM78B antibody (70R-4118)

Rabbit polyclonal FAM78B antibody raised against the middle region of FAM78B

Synonyms Polyclonal FAM78B antibody, Anti-FAM78B antibody, FAM-78 antibody, FAM78, MGC131653 antibody, FAM 78, FAM-78, Family With Sequence Similarity 78 Member B antibody, FAM 78 antibody
Specificity FAM78B antibody was raised against the middle region of FAM78B
Cross Reactivity Human,Mouse,Rat
Applications WB
Immunogen FAM78B antibody was raised using the middle region of FAM78B corresponding to a region with amino acids PSVTWAVPVSDSNVPLLTRIKRDQSFTTWLVAMNTTTKEKIILQTIKWRM
Assay Information FAM78B Blocking Peptide, catalog no. 33R-7380, is also available for use as a blocking control in assays to test for specificity of this FAM78B antibody


Western Blot analysis using FAM78B antibody (70R-4118)

FAM78B antibody (70R-4118) used at 1 ug/ml to detect target protein.


Host Rabbit
Method of Purification Affinity purified
Molecular Weight 30 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of FAM78B antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance The function of FAM78B protein has not been widely studied, and is yet to be fully elucidated.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Western Blot analysis using FAM78B antibody (70R-4118) | FAM78B antibody (70R-4118) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
View Our Distributors