FAM82A antibody (70R-3583)

Rabbit polyclonal FAM82A antibody raised against the middle region of Fam82A

Synonyms Polyclonal FAM82A antibody, Anti-FAM82A antibody, FAM 82, Family With Sequence Similarity 82 Member A antibody, FAM 82 antibody, FLJ38143 antibody, MGC33318 antibody, PRO34163 antibody, FAM-82 antibody, FLJ32954 antibody, BLOCK18 antibody, PYST9371 antibody, FAM-82, FAM82
Specificity FAM82A antibody was raised against the middle region of Fam82A
Cross Reactivity Human,Mouse,Rat
Applications WB
Immunogen FAM82A antibody was raised using the middle region of Fam82A corresponding to a region with amino acids RAPMNGHCHLWYAVLCGYVSEFEGLQNKINYGHLFKEHLDIAIKLLPEEP
Assay Information FAM82A Blocking Peptide, catalog no. 33R-7819, is also available for use as a blocking control in assays to test for specificity of this FAM82A antibody

Images

Western Blot analysis using FAM82A antibody (70R-3583)

FAM82A antibody (70R-3583) used at 1 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 65 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of FAM82A antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance FAM82A belongs to the FAM82/RMD family. It is a single-pass membrane protein. The function of the FAM82A protein remains unknown.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using FAM82A antibody (70R-3583) | FAM82A antibody (70R-3583) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
OR
Shipping
View Our Distributors