FAM82B antibody (70R-4099)

Rabbit polyclonal FAM82B antibody raised against the N terminal of FAM82B

Synonyms Polyclonal FAM82B antibody, Anti-FAM82B antibody, FAM-82 antibody, FLJ20665 antibody, FAM-82, CGI-90 antibody, Family With Sequence Similarity 82 Member B antibody, FAM82, FAM 82, FAM 82 antibody
Specificity FAM82B antibody was raised against the N terminal of FAM82B
Cross Reactivity Human
Applications WB
Immunogen FAM82B antibody was raised using the N terminal of FAM82B corresponding to a region with amino acids MALAARLWRLLPFRRGAAPGSRLPAGTSGSRGHCGPCRFRGFEVMGNPGT
Assay Information FAM82B Blocking Peptide, catalog no. 33R-5682, is also available for use as a blocking control in assays to test for specificity of this FAM82B antibody


Western Blot analysis using FAM82B antibody (70R-4099)

FAM82B antibody (70R-4099) used at 1 ug/ml to detect target protein.


Host Rabbit
Method of Purification Affinity purified
Molecular Weight 36 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of FAM82B antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance The specific function of FAM82B is not yet known.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Western Blot analysis using FAM82B antibody (70R-4099) | FAM82B antibody (70R-4099) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
View Our Distributors