FAM83E antibody (70R-3875)

Rabbit polyclonal FAM83E antibody raised against the middle region of FAM83E

Synonyms Polyclonal FAM83E antibody, Anti-FAM83E antibody, FAM83, FAM-83 antibody, Family With Sequence Similarity 83 Member E antibody, FAM 83, MGC138175 antibody, FAM-83, FLJ20200 antibody, MGC138177 antibody, FAM 83 antibody
Specificity FAM83E antibody was raised against the middle region of FAM83E
Cross Reactivity Human
Applications WB
Immunogen FAM83E antibody was raised using the middle region of FAM83E corresponding to a region with amino acids RARTPSGPPARPSRSMWDLSRLSQLSGSSDGDNELKKSWGSKDTPAKALM
Assay Information FAM83E Blocking Peptide, catalog no. 33R-7823, is also available for use as a blocking control in assays to test for specificity of this FAM83E antibody

Images

Western Blot analysis using FAM83E antibody (70R-3875)

FAM83E antibody (70R-3875) used at 1 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 52 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of FAM83E antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance The function of FAM83 protein is not widely studied, and is yet to be elucidated fully.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using FAM83E antibody (70R-3875) | FAM83E antibody (70R-3875) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
OR
Shipping
View Our Distributors