FAM84A antibody (70R-3537)

Rabbit polyclonal FAM84A antibody raised against the N terminal of FAM84A

Synonyms Polyclonal FAM84A antibody, Anti-FAM84A antibody, FAM-84 antibody, Family With Sequence Similarity 84 Member A antibody, FLJ35392 antibody, FAM 84 antibody, NSE1 antibody, FAM 84, PP11517 antibody, FAM-84, FAM84
Specificity FAM84A antibody was raised against the N terminal of FAM84A
Cross Reactivity Human,Mouse,Rat
Applications WB
Immunogen FAM84A antibody was raised using the N terminal of FAM84A corresponding to a region with amino acids GNQLDRITHLNYSELPTGDPSGIEKDELRVGVAYFFSDDEEDLDERGQPD
Assay Information FAM84A Blocking Peptide, catalog no. 33R-3455, is also available for use as a blocking control in assays to test for specificity of this FAM84A antibody

Images

Western Blot analysis using FAM84A antibody (70R-3537)

FAM84A antibody (70R-3537) used at 1 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 32 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of FAM84A antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance FAM84A belongs to the FAM84 family. Up-regulation of FAM84A may play a critical role in progression of colon cancer.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using FAM84A antibody (70R-3537) | FAM84A antibody (70R-3537) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
OR
Shipping
View Our Distributors