FAM92B antibody (70R-3362)

Rabbit polyclonal FAM92B antibody raised against the N terminal of FAM92B

Synonyms Polyclonal FAM92B antibody, Anti-FAM92B antibody, MGC138149 antibody, FAM92, FAM 92, FAM-92 antibody, FAM-92, FAM 92 antibody, Family With Sequence Similarity 92 Member B antibody, FLJ44299 antibody
Specificity FAM92B antibody was raised against the N terminal of FAM92B
Cross Reactivity Human,Mouse,Rat
Applications WB
Immunogen FAM92B antibody was raised using the N terminal of FAM92B corresponding to a region with amino acids FAEDLAKVQDYRQAQVERLETKVVNPLKLYGAQIKQTRAEIKKFKHVQNH
Assay Information FAM92B Blocking Peptide, catalog no. 33R-2839, is also available for use as a blocking control in assays to test for specificity of this FAM92B antibody


Western Blot analysis using FAM92B antibody (70R-3362)

FAM92B antibody (70R-3362) used at 1 ug/ml to detect target protein.


Host Rabbit
Method of Purification Affinity purified
Molecular Weight 35 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of FAM92B antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance The function of FAM92 protein is not widely studied, and is yet to be elucidated fully.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Western Blot analysis using FAM92B antibody (70R-3362) | FAM92B antibody (70R-3362) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
View Our Distributors