FBLN1 antibody (70R-5356)

Rabbit polyclonal FBLN1 antibody raised against the N terminal of FBLN1

Synonyms Polyclonal FBLN1 antibody, Anti-FBLN1 antibody, FBLN antibody, Fibulin 1 antibody
Specificity FBLN1 antibody was raised against the N terminal of FBLN1
Cross Reactivity Human,Rat
Applications WB
Immunogen FBLN1 antibody was raised using the N terminal of FBLN1 corresponding to a region with amino acids CCVKSQETGDLDVGGLQETDKIIEVEEEQEDPYLNDRCRGGGPCKQQCRD
Assay Information FBLN1 Blocking Peptide, catalog no. 33R-1657, is also available for use as a blocking control in assays to test for specificity of this FBLN1 antibody

Images

Western Blot analysis using FBLN1 antibody (70R-5356)

FBLN1 antibody (70R-5356) used at 1 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 72 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of FBLN1 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance Fibulin 1 is a secreted glycoprotein that becomes incorporated into a fibrillar extracellular matrix. Calcium-binding is apparently required to mediate its binding to laminin and nidogen. It mediates platelet adhesion via binding fibrinogen.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using FBLN1 antibody (70R-5356) | FBLN1 antibody (70R-5356) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
OR
Shipping
View Our Distributors