FBP2 antibody (70R-3380)

Rabbit polyclonal FBP2 antibody raised against the middle region of FBP2

Synonyms Polyclonal FBP2 antibody, Anti-FBP2 antibody, Fructose-16-Bisphosphatase 2 antibody, MGC142192 antibody
Specificity FBP2 antibody was raised against the middle region of FBP2
Cross Reactivity Human
Applications WB
Immunogen FBP2 antibody was raised using the middle region of FBP2 corresponding to a region with amino acids YIIEQAGGLATTGTQPVLDVKPEAIHQRVPLILGSPEDVQEYLTCVQKNQ
Assay Information FBP2 Blocking Peptide, catalog no. 33R-10138, is also available for use as a blocking control in assays to test for specificity of this FBP2 antibody

Images

Western Blot analysis using FBP2 antibody (70R-3380)

FBP2 antibody (70R-3380) used at 1 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 37 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of FBP2 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance FBP2 is a gluconeogenesis regulatory enzyme which catalyzes the hydrolysis of fructose 1,6-bisphosphate to fructose 6-phosphate and inorganic phosphate.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using FBP2 antibody (70R-3380) | FBP2 antibody (70R-3380) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
OR
Shipping
View Our Distributors