FBXL14 antibody (70R-3779)

Rabbit polyclonal FBXL14 antibody raised against the N terminal of FBXL14

Synonyms Polyclonal FBXL14 antibody, Anti-FBXL14 antibody, F-Box And Leucine-Rich Repeat Protein 14 antibody, FBXL-14, FBXL 14, FBXL14, FBXL 14 antibody, FBXL-14 antibody, MGC40195 antibody, Fbl14 antibody
Specificity FBXL14 antibody was raised against the N terminal of FBXL14
Cross Reactivity Human,Mouse,Rat
Applications WB
Immunogen FBXL14 antibody was raised using the N terminal of FBXL14 corresponding to a region with amino acids WRDAAYHKSVWRGVEAKLHLRRANPSLFPSLQARGIRRVQILSLRRSLSY
Assay Information FBXL14 Blocking Peptide, catalog no. 33R-9997, is also available for use as a blocking control in assays to test for specificity of this FBXL14 antibody

Images

Western Blot analysis using FBXL14 antibody (70R-3779)

FBXL14 antibody (70R-3779) used at 1 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 46 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of FBXL14 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance FBXL14 is a substrate-recognition component of the SCF (SKP1-CUL1-F-box protein)-type E3 ubiquitin ligase complex.Members of the F-box protein family, such as FBXL14, are characterized by an approximately 40-amino acid F-box motif. SCF complexes, formed by SKP1, cullin, and F-box proteins, act as protein-ubiquitin ligases.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using FBXL14 antibody (70R-3779) | FBXL14 antibody (70R-3779) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
OR
Shipping
View Our Distributors