FBXL16 antibody (70R-3781)

Rabbit polyclonal FBXL16 antibody raised against the middle region of FBXL16

Synonyms Polyclonal FBXL16 antibody, Anti-FBXL16 antibody, FBXL-16 antibody, Fbl16 antibody, FBXL16, FBXL 16 antibody, c380A1.1 antibody, FBXL-16, MGC33974 antibody, F-Box And Leucine-Rich Repeat Protein 16 antibody, FLJ33735 antibody, C16orf22 antibody, FBXL 16
Specificity FBXL16 antibody was raised against the middle region of FBXL16
Cross Reactivity Human,Mouse,Rat
Applications WB
Immunogen FBXL16 antibody was raised using the middle region of FBXL16 corresponding to a region with amino acids GCPLLTTTGLSGLVQLQELEELELTNCPGATPELFKYFSQHLPRCLVIE
Assay Information FBXL16 Blocking Peptide, catalog no. 33R-3191, is also available for use as a blocking control in assays to test for specificity of this FBXL16 antibody

Images

Western Blot analysis using FBXL16 antibody (70R-3781)

FBXL16 antibody (70R-3781) used at 1 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 52 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of FBXL16 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance FBXL16 is a substrate-recognition component of the SCF (SKP1-CUL1-F-box protein)-type E3 ubiquitin ligase complex.Members of the F-box protein family, such as FBXL16, are characterized by an approximately 40-amino acid F-box motif. SCF complexes, formed by SKP1, cullin, and F-box proteins, act as protein-ubiquitin ligases.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using FBXL16 antibody (70R-3781) | FBXL16 antibody (70R-3781) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
OR
Shipping
View Our Distributors