FBXO15 antibody (70R-4393)

Rabbit polyclonal FBXO15 antibody raised against the N terminal of FBXO15

Synonyms Polyclonal FBXO15 antibody, Anti-FBXO15 antibody, FBXO-15 antibody, FBXO-15, FBXO 15 antibody, F-Box Protein 15 antibody, MGC39671 antibody, FBX15 antibody, FBXO15, FBXO 15
Specificity FBXO15 antibody was raised against the N terminal of FBXO15
Cross Reactivity Human,Rat
Applications WB
Immunogen FBXO15 antibody was raised using the N terminal of FBXO15 corresponding to a region with amino acids QDKEAGYWKKEYITKQIASVKAALADILKPVNPYTGLPVKTKEALRIFGL
Assay Information FBXO15 Blocking Peptide, catalog no. 33R-7503, is also available for use as a blocking control in assays to test for specificity of this FBXO15 antibody


Western Blot analysis using FBXO15 antibody (70R-4393)

FBXO15 antibody (70R-4393) used at 1 ug/ml to detect target protein.


Host Rabbit
Method of Purification Affinity purified
Molecular Weight 49 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of FBXO15 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance FBXO15 is the substrate-recognition component of the SCF (SKP1-CUL1-F-box protein)-type E3 ubiquitin ligase complex.Members of the F-box protein family, such as FBXO15, are characterized by an approximately 40-amino acid F-box motif. SCF complexes, formed by SKP1, cullin, and F-box proteins, act as protein-ubiquitin ligases. F-box proteins interact with SKP1 through the F box, and they interact with ubiquitination targets through other protein interaction domains.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Western Blot analysis using FBXO15 antibody (70R-4393) | FBXO15 antibody (70R-4393) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
View Our Distributors