FBXO22 antibody (70R-3753)

Rabbit polyclonal FBXO22 antibody raised against the middle region of FBXO22

Synonyms Polyclonal FBXO22 antibody, Anti-FBXO22 antibody, FBXO 22 antibody, FBXO22, FBXO-22, FBXO 22, FLJ13986 antibody, FBXO-22 antibody, FBX22 antibody, F-Box Protein 22 antibody, MGC31799 antibody
Specificity FBXO22 antibody was raised against the middle region of FBXO22
Cross Reactivity Human
Applications WB
Immunogen FBXO22 antibody was raised using the middle region of FBXO22 corresponding to a region with amino acids CCKVGASNYLQQVVSTFSDMNIILAGGQVDNLSSLTSEKYVLCASDFVCE
Assay Information FBXO22 Blocking Peptide, catalog no. 33R-1651, is also available for use as a blocking control in assays to test for specificity of this FBXO22 antibody

Western Blot analysis using FBXO22 antibody (70R-3753)

FBXO22 antibody (70R-3753) used at 1 ug/ml to detect target protein.

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 30 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of FBXO22 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance FBXO22 is a member of the F-box protein family which is characterized by an approximately 40 amino acid motif, the F-box. The F-box proteins constitute one of the four subunits of the ubiquitin protein ligase complex called SCFs (SKP1-cullin-F-box), which function in phosphorylation-dependent ubiquitination. The F-box proteins are divided into 3 classes: Fbws containing WD-40 domains, Fbls containing leucine-rich repeats, and Fbxs containing either different protein-protein interaction modules or no recognizable motifs. FBXO22 belongs to the Fbxs class. Two transcript variants encoding different isoforms exist for this gene.

Add a Paper

Sorry, but there are no references currently for this product.

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

  • Western Blot analysis using FBXO22 antibody (70R-3753) | FBXO22 antibody (70R-3753) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
View Our Distributors