FBXO27 antibody (70R-3150)

Rabbit polyclonal FBXO27 antibody raised against the middle region of FBXO27

Synonyms Polyclonal FBXO27 antibody, Anti-FBXO27 antibody, FBXO-27 antibody, F-Box Protein 27 antibody, FBXO-27, FBG5 antibody, FBXO 27 antibody, FBXO27, Fbx27 antibody, FBXO 27
Specificity FBXO27 antibody was raised against the middle region of FBXO27
Cross Reactivity Human
Applications WB
Immunogen FBXO27 antibody was raised using the middle region of FBXO27 corresponding to a region with amino acids LDKFSAVPDPIPQWNNNACLHVTHVFSNIKMGVRFVSFEHRGQDTQFWAG
Assay Information FBXO27 Blocking Peptide, catalog no. 33R-4851, is also available for use as a blocking control in assays to test for specificity of this FBXO27 antibody


Western Blot analysis using FBXO27 antibody (70R-3150)

FBXO27 antibody (70R-3150) used at 1 ug/ml to detect target protein.


Host Rabbit
Method of Purification Affinity purified
Molecular Weight 31 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of FBXO27 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance Members of the F-box protein family, such as FBXO27, are characterized by an approximately 40-amino acid F-box motif. SCF complexes, formed by SKP1, cullin, and F-box proteins, act as protein-ubiquitin ligases. F-box proteins interact with SKP1 through the F box, and they interact with ubiquitination targets through other protein interaction domains.Members of the F-box protein family, such as FBXO27, are characterized by an approximately 40-amino acid F-box motif. SCF complexes, formed by SKP1, cullin, and F-box proteins, act as protein-ubiquitin ligases. F-box proteins interact with SKP1 through the F box, and they interact with ubiquitination targets through other protein interaction domains.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Western Blot analysis using FBXO27 antibody (70R-3150) | FBXO27 antibody (70R-3150) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
View Our Distributors