FBXO33 antibody (70R-3799)

Rabbit polyclonal FBXO33 antibody raised against the middle region of FBXO33

Synonyms Polyclonal FBXO33 antibody, Anti-FBXO33 antibody, FBXO 33, FBXO 33 antibody, Fbx33 antibody, F-Box Protein 33 antibody, c14_5247 antibody, FBXO-33 antibody, FBXO-33, FBXO33
Specificity FBXO33 antibody was raised against the middle region of FBXO33
Cross Reactivity Human,Mouse,Rat
Applications WB
Immunogen FBXO33 antibody was raised using the middle region of FBXO33 corresponding to a region with amino acids VIDTSGFPDLSDNRNEDPLVLLAWRCTKLSLLAIHGYTVWAHNLIAIARL
Assay Information FBXO33 Blocking Peptide, catalog no. 33R-9590, is also available for use as a blocking control in assays to test for specificity of this FBXO33 antibody


Western Blot analysis using FBXO33 antibody (70R-3799)

FBXO33 antibody (70R-3799) used at 1 ug/ml to detect target protein.


Host Rabbit
Method of Purification Affinity purified
Molecular Weight 62 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of FBXO33 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance FBXO33 is the substrate recognition component of a (SKP1-CUL1-F-box protein) E3 ubiquitin-protein ligase complex which mediates the ubiquitination and subsequent proteasomal degradation of target proteins. FBXO33 probably recognises and binds to phosphorylated target proteins. recognises YBX1.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Western Blot analysis using FBXO33 antibody (70R-3799) | FBXO33 antibody (70R-3799) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
View Our Distributors