FBXO36 antibody (70R-3784)

Rabbit polyclonal FBXO36 antibody raised against the N terminal of FBXO36

Synonyms Polyclonal FBXO36 antibody, Anti-FBXO36 antibody, FBXO36, F-Box Protein 36 antibody, FBXO-36 antibody, FLJ41090 antibody, FBXO 36, FLJ37592 antibody, FBXO-36, FBXO 36 antibody, Fbx36 antibody
Specificity FBXO36 antibody was raised against the N terminal of FBXO36
Cross Reactivity Human
Applications WB
Immunogen FBXO36 antibody was raised using the N terminal of FBXO36 corresponding to a region with amino acids QVIFRWWKISLRSEYRSTKPGEAKETHEDFLENSHLQGQTALIFGARILD
Assay Information FBXO36 Blocking Peptide, catalog no. 33R-7774, is also available for use as a blocking control in assays to test for specificity of this FBXO36 antibody


Western Blot analysis using FBXO36 antibody (70R-3784)

FBXO36 antibody (70R-3784) used at 1 ug/ml to detect target protein.


Host Rabbit
Method of Purification Affinity purified
Molecular Weight 22 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of FBXO36 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance Members of the F-box protein family, such as FBXO36, are characterized by an approximately 40-amino acid F-box motif. SCF complexes, formed by SKP1, cullin, and F-box proteins, act as protein-ubiquitin ligases. F-box proteins interact with SKP1 through the F box, and they interact with ubiquitination targets through other protein interaction domains.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Western Blot analysis using FBXO36 antibody (70R-3784) | FBXO36 antibody (70R-3784) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
View Our Distributors