FBXO39 antibody (70R-3430)

Rabbit polyclonal FBXO39 antibody raised against the N terminal of FBXO39

Synonyms Polyclonal FBXO39 antibody, Anti-FBXO39 antibody, FBXO39, FBXO 39, F-Box Protein 39 antibody, MGC35179 antibody, FBXO-39, FBXO 39 antibody, FBXO-39 antibody, Fbx39 antibody
Specificity FBXO39 antibody was raised against the N terminal of FBXO39
Cross Reactivity Human
Applications WB
Immunogen FBXO39 antibody was raised using the N terminal of FBXO39 corresponding to a region with amino acids DRSRAALVCRKWNQMMYSAELWRYRTITFSGRPSRVHASEVESAVWYVKK
Assay Information FBXO39 Blocking Peptide, catalog no. 33R-2151, is also available for use as a blocking control in assays to test for specificity of this FBXO39 antibody

Images

Western Blot analysis using FBXO39 antibody (70R-3430)

FBXO39 antibody (70R-3430) used at 1 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 53 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of FBXO39 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance FBXO39 is a substrate-recognition component of the SCF (SKP1-CUL1-F-box protein)-type E3 ubiquitin ligase complex.Members of the F-box protein family, such as FBXO39, are characterized by an approximately 40-amino acid F-box motif. SCF complexes, formed by SKP1, cullin, and F-box proteins, act as protein-ubiquitin ligases. F-box proteins interact with SKP1 through the F box, and they interact with ubiquitination targets through other protein interaction domains.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using FBXO39 antibody (70R-3430) | FBXO39 antibody (70R-3430) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
OR
Shipping
View Our Distributors