FBXO39 antibody (70R-3431)

Rabbit polyclonal FBXO39 antibody raised against the middle region of FBXO39

Synonyms Polyclonal FBXO39 antibody, Anti-FBXO39 antibody, Fbx39 antibody, FBXO39, MGC35179 antibody, FBXO-39, FBXO-39 antibody, FBXO 39 antibody, F-Box Protein 39 antibody, FBXO 39
Specificity FBXO39 antibody was raised against the middle region of FBXO39
Cross Reactivity Human
Applications WB
Immunogen FBXO39 antibody was raised using the middle region of FBXO39 corresponding to a region with amino acids RQCALRVFKARIYTNRYETNEEDKTLQEIYRKYRKLIESELSYFVIVYSV
Assay Information FBXO39 Blocking Peptide, catalog no. 33R-8114, is also available for use as a blocking control in assays to test for specificity of this FBXO39 antibody

Images

Western Blot analysis using FBXO39 antibody (70R-3431)

FBXO39 antibody (70R-3431) used at 1 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 53 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of FBXO39 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance FBXO39 is the substrate-recognition component of the SCF (SKP1-CUL1-F-box protein)-type E3 ubiquitin ligase complex.Members of the F-box protein family, such as FBXO39, are characterized by an approximately 40-amino acid F-box motif. SCF complexes, formed by SKP1, cullin, and F-box proteins, act as protein-ubiquitin ligases. F-box proteins interact with SKP1 through the F box, and they interact with ubiquitination targets through other protein interaction domains.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using FBXO39 antibody (70R-3431) | FBXO39 antibody (70R-3431) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
OR
Shipping
View Our Distributors