FBXW10 antibody (70R-3251)

Rabbit polyclonal FBXW10 antibody raised against the middle region of FBXW10

Synonyms Polyclonal FBXW10 antibody, Anti-FBXW10 antibody, HREP antibody, F-Box And Wd Repeat Domain Containing 10 antibody, Fbw10 antibody, SM25H2 antibody, FBXW 10, SM2SH2 antibody, FBXW-10, FBXW-10 antibody, FBXW 10 antibody, FBXW10
Specificity FBXW10 antibody was raised against the middle region of FBXW10
Cross Reactivity Human,Mouse
Applications WB
Immunogen FBXW10 antibody was raised using the middle region of FBXW10 corresponding to a region with amino acids RKIHLLDIIQVKAIPVEFRGHAGSVRALFLCEEENFLLSGSYDLSIRYWD
Assay Information FBXW10 Blocking Peptide, catalog no. 33R-7996, is also available for use as a blocking control in assays to test for specificity of this FBXW10 antibody

Images

Western Blot analysis using FBXW10 antibody (70R-3251)

FBXW10 antibody (70R-3251) used at 1 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 120 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of FBXW10 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance Members of the F-box protein family, such as FBXW10, are characterized by an approximately 40-amino acid F-box motif. SCF complexes, formed by SKP1, cullin, and F-box proteins, act as protein-ubiquitin ligases. F-box proteins interact with SKP1 through the F box, and they interact with ubiquitination targets through other protein interaction domains.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using FBXW10 antibody (70R-3251) | FBXW10 antibody (70R-3251) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
OR
Shipping
View Our Distributors