FBXW8 antibody (70R-3252)

Rabbit polyclonal FBXW8 antibody raised against the middle region of FBXW8

Synonyms Polyclonal FBXW8 antibody, Anti-FBXW8 antibody, MGC33534 antibody, FBXW8, FBXW-8, FBW6 antibody, FBXW-8 antibody, FBXW 8 antibody, FBX29 antibody, FBXW 8, F-Box And Wd Repeat Domain Containing 8 antibody, FBXO29 antibody, FBW8 antibody
Specificity FBXW8 antibody was raised against the middle region of FBXW8
Cross Reactivity Human
Applications WB
Immunogen FBXW8 antibody was raised using the middle region of FBXW8 corresponding to a region with amino acids MNQKLWEVYSGHPVQHISFSSHSLITANVPYQTVMRNADLDSFTTHRRHR
Assay Information FBXW8 Blocking Peptide, catalog no. 33R-6260, is also available for use as a blocking control in assays to test for specificity of this FBXW8 antibody


Western Blot analysis using FBXW8 antibody (70R-3252)

FBXW8 antibody (70R-3252) used at 1 ug/ml to detect target protein.


Host Rabbit
Method of Purification Affinity purified
Molecular Weight 67 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of FBXW8 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance FBXW8 is a member of the F-box protein family, members of which are characterized by an approximately 40 amino acid motif, the F-box. The F-box proteins constitute one of the four subunits of ubiquitin protein ligase complex called SCFs (SKP1-cullin-F-box), which function in phosphorylation-dependent ubiquitination. The F-box proteins are divided into three classes: Fbws containing WD-40 domains, Fbls containing leucine-rich repeats, and Fbxs containing either different protein-protein interaction modules or no recognizable motifs. FBXW8 contains a WD-40 domain, in addition to an F-box motif, so it belongs to the Fbw class.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Western Blot analysis using FBXW8 antibody (70R-3252) | FBXW8 antibody (70R-3252) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
View Our Distributors