FCER1A antibody (70R-6650)

Rabbit polyclonal FCER1A antibody raised against the N terminal of FCER1A

Synonyms Polyclonal FCER1A antibody, Anti-FCER1A antibody, FCER1A, FCE1A antibody, FCERA 1, Fc Fragment Of Ige High Affinity I Receptor For; Alpha Polypeptide antibody, FCERA-1 antibody, FCERA-1, FcERI antibody, FCERA 1 antibody
Specificity FCER1A antibody was raised against the N terminal of FCER1A
Cross Reactivity Human
Applications WB
Immunogen FCER1A antibody was raised using the N terminal of FCER1A corresponding to a region with amino acids NPPWNRIFKGENVTLTCNGNNFFEVSSTKWFHNGSLSEETNSSLNIVNAK
Assay Information FCER1A Blocking Peptide, catalog no. 33R-6827, is also available for use as a blocking control in assays to test for specificity of this FCER1A antibody

Images

Western Blot analysis using FCER1A antibody (70R-6650)

FCER1A antibody (70R-6650) used at 1 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 27 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of FCER1A antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance The IgE receptor plays a central role in allergic disease, coupling allergen and mast cell to initiate the inflammatory and immediate hypersensitivity responses that are characteristic of disorders such as hay fever and asthma. The allergic response occurs when 2 or more high-affinity IgE receptors are crosslinked via IgE molecules that in turn are bound to an allergen (antigen) molecule.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using FCER1A antibody (70R-6650) | FCER1A antibody (70R-6650) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
OR
Shipping
View Our Distributors