FCGRT antibody (70R-5991)

Rabbit polyclonal FCGRT antibody raised against the N terminal of FCGRT

Synonyms Polyclonal FCGRT antibody, Anti-FCGRT antibody, alpha-chain antibody, FCRN antibody, Fc Fragment Of Igg Receptor Transporter Alpha antibody
Specificity FCGRT antibody was raised against the N terminal of FCGRT
Cross Reactivity Human
Applications WB
Immunogen FCGRT antibody was raised using the N terminal of FCGRT corresponding to a region with amino acids GWLGPQQYLSYNSLRGEAEPCGAWVWENQVSWYWEKETTDLRIKEKLFLE
Assay Information FCGRT Blocking Peptide, catalog no. 33R-3667, is also available for use as a blocking control in assays to test for specificity of this FCGRT antibody

Images

Western Blot analysis using FCGRT antibody (70R-5991)

FCGRT antibody (70R-5991) used at 0.5 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 40 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of FCGRT antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 0.5 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance FCGRT binds to the Fc region of monomeric immunoglobulins gamma. It mediates the uptake of IgG from milk. It plays a possible role in transfer of immunoglobulin G from mother to fetus.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using FCGRT antibody (70R-5991) | FCGRT antibody (70R-5991) used at 0.5 ug/ml to detect target protein.

Availability: In stock

Price: $375.00
Size: 50 ug
OR
Shipping
View Our Distributors