FCN3 antibody (70R-5456)

Rabbit polyclonal FCN3 antibody raised against the N terminal of FCN3

Synonyms Polyclonal FCN3 antibody, Anti-FCN3 antibody, FCNH antibody, Ficolin antibody, MGC22543 antibody, Collagen/Fibrinogen Domain Containing 3 antibody, HAKA1 antibody
Specificity FCN3 antibody was raised against the N terminal of FCN3
Cross Reactivity Human
Applications WB
Immunogen FCN3 antibody was raised using the N terminal of FCN3 corresponding to a region with amino acids LEASKVVLLPSCPGAPGSPGEKGAPGPQGPPGPPGKMGPKGEPGDPVNLL
Assay Information FCN3 Blocking Peptide, catalog no. 33R-4879, is also available for use as a blocking control in assays to test for specificity of this FCN3 antibody


Western Blot analysis using FCN3 antibody (70R-5456)

FCN3 antibody (70R-5456) used at 1 ug/ml to detect target protein.


Host Rabbit
Method of Purification Affinity purified
Molecular Weight 31 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of FCN3 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance Ficolins are a group of proteins which consist of a collagen-like domain and a fibrinogen-like domain. In human serum, there are two types of ficolins, both of which have lectin activity.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Western Blot analysis using FCN3 antibody (70R-5456) | FCN3 antibody (70R-5456) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
View Our Distributors