FCRL4 antibody (70R-7228)

Rabbit polyclonal FCRL4 antibody raised against the N terminal of FCRL4

Synonyms Polyclonal FCRL4 antibody, Anti-FCRL4 antibody, FCRL-4, FCRL 4, IRTA1 antibody, FCRL4, Fc Receptor-Like 4 antibody, dJ801G22.1 antibody, FCRL 4 antibody, MGC150522 antibody, FCRL-4 antibody, MGC150523 antibody, IGFP2 antibody, FCRH4 antibody
Specificity FCRL4 antibody was raised against the N terminal of FCRL4
Cross Reactivity Human
Applications WB
Immunogen FCRL4 antibody was raised using the N terminal of FCRL4 corresponding to a region with amino acids FKGERVTLTCNGFQFYATEKTTWYHRHYWGEKLTLTPGNTLEVRESGLYR
Assay Information FCRL4 Blocking Peptide, catalog no. 33R-2948, is also available for use as a blocking control in assays to test for specificity of this FCRL4 antibody

Images

Western Blot analysis using FCRL4 antibody (70R-7228)

FCRL4 antibody (70R-7228) used at 1 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 57 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of FCRL4 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance FCRL4 may function as an inhibitor of the B cell receptor signaling and in the B cell-mediated immune response.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using FCRL4 antibody (70R-7228) | FCRL4 antibody (70R-7228) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
OR
Shipping
View Our Distributors