FCRLA antibody (70R-7201)

Rabbit polyclonal FCRLA antibody raised against the C terminal of FCRLA

Synonyms Polyclonal FCRLA antibody, Anti-FCRLA antibody, FCRLb antibody, FCRLM1 antibody, RP11-474I16.5 antibody, FCRLc2 antibody, Fc Receptor-Like A antibody, FCRLd antibody, FCRLX antibody, FCRLe antibody, FREB antibody, FCRLc1 antibody, FCRL antibody, MGC4595 antibody
Specificity FCRLA antibody was raised against the C terminal of FCRLA
Cross Reactivity Human
Applications WB
Immunogen FCRLA antibody was raised using the C terminal of FCRLA corresponding to a region with amino acids MPDPHLYHQMGLLLKHMQDVRVLLGHLLMELRELSGHRKPGTTKATAE
Assay Information FCRLA Blocking Peptide, catalog no. 33R-6273, is also available for use as a blocking control in assays to test for specificity of this FCRLA antibody

Images

Western Blot analysis using FCRLA antibody (70R-7201)

FCRLA antibody (70R-7201) used at 1 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 41 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of FCRLA antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance Receptors for the Fc fragment of IgG, or FCGRs, are cell surface glycoproteins of the Ig superfamily (IgSF). These receptors mediate phagocytosis of IgG-coated pathogens and promote activation of effector cells, leading to inflammatory responses and antibody-mediated cellular cytotoxicity. FCRLA may be implicated in B-cell differentiation and lymphomagenesis.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using FCRLA antibody (70R-7201) | FCRLA antibody (70R-7201) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
OR
Shipping
View Our Distributors