FEM1B antibody (70R-6027)

Rabbit polyclonal FEM1B antibody

Synonyms Polyclonal FEM1B antibody, Anti-FEM1B antibody, FEMB 1, FIAA antibody, Fem-1 Homolog B antibody, FEMB 1 antibody, FEMB-1 antibody, FEM1B, FEMB-1, DKFZp451E0710 antibody
Cross Reactivity Human,Mouse,Rat
Applications WB
Immunogen FEM1B antibody was raised using a synthetic peptide corresponding to a region with amino acids DKSTTGVSEILLKTQMKMSLKCLAARAVRANDINYQDQIPRTLEEFVGFH
Assay Information FEM1B Blocking Peptide, catalog no. 33R-2032, is also available for use as a blocking control in assays to test for specificity of this FEM1B antibody

Images

Western Blot analysis using FEM1B antibody (70R-6027)

FEM1B antibody (70R-6027) used at 1 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 69 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of FEM1B antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance FEM1B is a component of an E3 ubiquitin-protein ligase complex, in which it may act as a substrate recognition subunit. It involved in apoptosis by acting as a death receptor-associated protein that mediates apoptosis. FEM1B also involved in glucose homeostasis in pancreatic islet.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using FEM1B antibody (70R-6027) | FEM1B antibody (70R-6027) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
OR
Shipping
View Our Distributors