FER1L3 antibody (70R-6290)

Rabbit polyclonal FER1L3 antibody

Synonyms Polyclonal FER1L3 antibody, Anti-FER1L3 antibody, FERL3-1 antibody, FERL3 1, FERL3-1, FLJ36571 antibody, FLJ90777 antibody, FERL3 1 antibody, FER1L3, Fer-1-Like 3 Myoferlin antibody, MYOF antibody
Cross Reactivity Human
Applications WB
Immunogen FER1L3 antibody was raised using a synthetic peptide corresponding to a region with amino acids QTEFRIPPRLIIQIWDNDKFSLDDYLGFLELDLRHTIIPAKSPEKCRLDM
Assay Information FER1L3 Blocking Peptide, catalog no. 33R-7747, is also available for use as a blocking control in assays to test for specificity of this FER1L3 antibody

Images

Western Blot analysis using FER1L3 antibody (70R-6290)

FER1L3 antibody (70R-6290) used at 1 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 235 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of FER1L3 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance Mutations in dysferlin, a protein associated with the plasma membrane, can cause muscle weakness that affects both proximal and distal muscles. FER1L3 is a type II membrane protein that is structurally similar to dysferlin. It is a member of the ferlin family and associates with both plasma and nuclear membranes. The protein contains C2 domains that play a role in calcium-mediated membrane fusion events, suggesting that it may be involved in membrane regeneration and repair.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using FER1L3 antibody (70R-6290) | FER1L3 antibody (70R-6290) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
OR
Shipping
View Our Distributors