FETUB antibody (70R-5424)

Rabbit polyclonal FETUB antibody raised against the N terminal of FETUB

Synonyms Polyclonal FETUB antibody, Anti-FETUB antibody, IRL685 antibody, Gugu antibody, 16G2 antibody, Fetuin B antibody
Specificity FETUB antibody was raised against the N terminal of FETUB
Cross Reactivity Human
Applications WB
Immunogen FETUB antibody was raised using the N terminal of FETUB corresponding to a region with amino acids GCNDSDVLAVAGFALRDINKDRKDGYVLRLNRVNDAQEYRRGGLGSLFYL
Assay Information FETUB Blocking Peptide, catalog no. 33R-3189, is also available for use as a blocking control in assays to test for specificity of this FETUB antibody

Images

Western Blot analysis using FETUB antibody (70R-5424)

FETUB antibody (70R-5424) used at 1 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 42 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of FETUB antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance The protein encoded by this gene is a member of the fetuin family, part of the cystatin superfamily of cysteine protease inhibitors. Fetuins have been implicated in several diverse functions, including osteogenesis and bone resorption.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using FETUB antibody (70R-5424) | FETUB antibody (70R-5424) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
OR
Shipping
View Our Distributors