FGF21 antibody (70R-6198)

Rabbit polyclonal FGF21 antibody raised against the N terminal of FGF21

Synonyms Polyclonal FGF21 antibody, Anti-FGF21 antibody, FGF-21 antibody, FGF 21 antibody, FGF 21, FGF-21, Fibroblast Growth Factor 21 antibody, FGF21
Specificity FGF21 antibody was raised against the N terminal of FGF21
Cross Reactivity Human,Mouse,Rat
Applications WB
Immunogen FGF21 antibody was raised using the N terminal of FGF21 corresponding to a region with amino acids DSDETGFEHSGLWVSVLAGLLLGACQAHPIPDSSPLLQFGGQVRQRYLYT
Assay Information FGF21 Blocking Peptide, catalog no. 33R-2157, is also available for use as a blocking control in assays to test for specificity of this FGF21 antibody

Images

Western blot analysis using FGF21 antibody (70R-6198)

Recommended FGF21 Antibody Titration: 0.2-1 ug/ml

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 19 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of FGF21 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance FGF21 is a member of the fibroblast growth factor (FGF) family. FGF family members possess broad mitogenic and cell survival activities and are involved in a variety of biological processes including embryonic development, cell growth, morphogenesis, tissue repair, tumor growth and invasion. The function of this growth factor has not yet been determined.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western blot analysis using FGF21 antibody (70R-6198) | Recommended FGF21 Antibody Titration: 0.2-1 ug/ml
  • Immunohistochemical staining using FGF21 antibody (70R-6198) | Liver
  • Western blot analysis using FGF21 antibody (70R-6198) | Tissue analyzed: Jurkat Whole Cell Lane A: Primary Antibody Lane B: Primary Antibody + Blocking Peptide. Primary Antibody Concentration: 1ug/ml; Peptide Concentration: 5ug/ml Lysate Quantity: 25ug/lane Gel Concentration: 0.12%

Availability: In stock

Price: $375.00
Size: 50 ug
OR
Shipping
View Our Distributors