FGL1 antibody (70R-5365)

Rabbit polyclonal FGL1 antibody raised against the middle region of FGL1

Synonyms Polyclonal FGL1 antibody, Anti-FGL1 antibody, HFREP1 antibody, HP-041 antibody, Fibrinogen-Like 1 antibody, MGC12455 antibody, LFIRE1 antibody
Specificity FGL1 antibody was raised against the middle region of FGL1
Cross Reactivity Human
Applications WB
Immunogen FGL1 antibody was raised using the middle region of FGL1 corresponding to a region with amino acids EFSVYCDMSDGGGWTVIQRRSDGSENFNRGWKDYENGFGNFVQKHGEYWL
Assay Information FGL1 Blocking Peptide, catalog no. 33R-2413, is also available for use as a blocking control in assays to test for specificity of this FGL1 antibody

Images

Western Blot analysis using FGL1 antibody (70R-5365)

FGL1 antibody (70R-5365) used at 1 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 34 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of FGL1 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance Fibrinogen-like 1 is a member of the fibrinogen family. This protein is homologous to the carboxy terminus of the fibrinogen beta- and gamma- subunits which contains the four conserved cysteines of fibrinogens and fibrinogen related proteins.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using FGL1 antibody (70R-5365) | FGL1 antibody (70R-5365) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
OR
Shipping
View Our Distributors