FHIT antibody (70R-4587)

Rabbit polyclonal FHIT antibody raised against the middle region of FHIT

Synonyms Polyclonal FHIT antibody, Anti-FHIT antibody, Fragile Histidine Triad Gene antibody, AP3Aase antibody, FRA3B antibody
Specificity FHIT antibody was raised against the middle region of FHIT
Cross Reactivity Human
Applications WB
Immunogen FHIT antibody was raised using the middle region of FHIT corresponding to a region with amino acids VHVLPRKAGDFHRNDSIYEELQKHDKEDFPASWRSEEEMAAEAAALRVYF
Assay Information FHIT Blocking Peptide, catalog no. 33R-9585, is also available for use as a blocking control in assays to test for specificity of this FHIT antibody


Western Blot analysis using FHIT antibody (70R-4587)

FHIT antibody (70R-4587) used at 1 ug/ml to detect target protein.


Host Rabbit
Method of Purification Affinity purified
Molecular Weight 17 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of FHIT antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance This gene, a member of the histidine triad gene family, encodes a diadenosine 5',5'''-P1,P3-triphosphate hydrolase involved in purine metabolism. The gene encompasses the common fragile site FRA3B on chromosome 3, where carcinogen-induced damage can lead to translocations and aberrant transcripts of this gene. In fact, aberrant transcripts from this gene have been found in about half of all esophageal, stomach, and colon carcinomas. Alternatively spliced transcript variants have been found for this gene.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Western Blot analysis using FHIT antibody (70R-4587) | FHIT antibody (70R-4587) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
View Our Distributors