FHOD3 antibody (70R-2156)

Rabbit polyclonal FHOD3 antibody raised against the C terminal of FHOD3

Synonyms Polyclonal FHOD3 antibody, Anti-FHOD3 antibody, Formin Homology 2 Domain Containing 3 antibody, FHOD-3 antibody, FHOD3, FHOD 3, FHOD 3 antibody, FHOD-3, Formactin2 antibody, FHOS2 antibody
Specificity FHOD3 antibody was raised against the C terminal of FHOD3
Cross Reactivity Human
Applications IHC, WB
Immunogen FHOD3 antibody was raised using the C terminal of FHOD3 corresponding to a region with amino acids SGKFSGSSPAPPSQPQGLSYAEDAAEHENMKAVLKTSSPSVEDATPALGV
Assay Information FHOD3 Blocking Peptide, catalog no. 33R-8468, is also available for use as a blocking control in assays to test for specificity of this FHOD3 antibody


Western Blot analysis using FHOD3 antibody (70R-2156)

FHOD3 antibody (70R-2156) used at 1 ug/ml to detect target protein.


Host Rabbit
Method of Purification Affinity purified
Molecular Weight 60 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of FHOD3 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml; IHC: 4-8 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance Proteins that contain formin homology (FH) domains, such as FHOD3, play a role in regulation of the actin cytoskeleton.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Western Blot analysis using FHOD3 antibody (70R-2156) | FHOD3 antibody (70R-2156) used at 1 ug/ml to detect target protein.
  • Immunohistochemical staining using FHOD3 antibody (70R-2156) | FHOD3 antibody was used for immunohistochemistry at a concentration of 4-8 ug/ml to stain Epithelial cells of renal tubule (arrows) in Human Kidney. Magnification is at 400X

Availability: In stock

Price: $345.00
Size: 50 ug
View Our Distributors