Fibronectin 1 antibody (70R-6082)

Rabbit polyclonal Fibronectin 1 antibody raised against the N terminal of FN1

Synonyms Polyclonal Fibronectin 1 antibody, Anti-Fibronectin 1 antibody, MSF antibody, DKFZp686I1370 antibody, DKFZp686O13149 antibody, FINC antibody, FN antibody, CIG antibody, LETS antibody, DKFZp686F10164 antibody, FN1 antibody, DKFZp686H0342 antibody
Specificity Fibronectin 1 antibody was raised against the N terminal of FN1
Cross Reactivity Human
Applications WB
Immunogen Fibronectin 1 antibody was raised using the N terminal of FN1 corresponding to a region with amino acids GNALVCTCYGGSRGFNCESKPEAEETCFDKYTGNTYRVGDTYERPKDSMI
Assay Information Fibronectin 1 Blocking Peptide, catalog no. 33R-3443, is also available for use as a blocking control in assays to test for specificity of this Fibronectin 1 antibody

Images

Western Blot analysis using Fibronectin 1 antibody (70R-6082)

Fibronectin 1 antibody (70R-6082) used at 1 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 71 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of FN1 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance FN1 is a glycoprotein present in a soluble dimeric form in plasma, and in a dimeric or multimeric form at the cell surface and in extracellular matrix. Fibronectin is involved in cell adhesion and migration processes including embryogenesis and wound healing.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using Fibronectin 1 antibody (70R-6082) | Fibronectin 1 antibody (70R-6082) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
OR
Shipping
View Our Distributors