FICD antibody (70R-5702)

Rabbit polyclonal FICD antibody raised against the C terminal of FICD

Synonyms Polyclonal FICD antibody, Anti-FICD antibody, MGC5623 antibody, Fic Domain Containing antibody, UNQ3041 antibody, hip13 antibody, HYPE antibody
Specificity FICD antibody was raised against the C terminal of FICD
Cross Reactivity Human
Applications IHC, WB
Immunogen FICD antibody was raised using the C terminal of FICD corresponding to a region with amino acids GDVRPFIRFIAKCTETTLDTLLFATTEYSVALPEAQPNHSGFKETLPVKP
Assay Information FICD Blocking Peptide, catalog no. 33R-3215, is also available for use as a blocking control in assays to test for specificity of this FICD antibody


Immunohistochemical staining using FICD antibody (70R-5702)

FICD antibody was used for immunohistochemistry at a concentration of 4-8 ug/ml to stain Skeletal muscle cells (arrows) in Human Muscle. Magnification is at 400X


Host Rabbit
Method of Purification Affinity purified
Molecular Weight 52 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of FICD antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 0.25 ug/ml; IHC: 4-8 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance FICD is an adenylyltransferase that mediates the addition of adenosine 5'-monophosphate (AMP) to specific residues of target proteins. It is able to inactivate Rho GTPases in vitro by adding AMP to RhoA, Rac and Cdc42. It is however unclear whether it inactivates GTPases in vivo and physiological substrates probably remain to be identified.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Immunohistochemical staining using FICD antibody (70R-5702) | FICD antibody was used for immunohistochemistry at a concentration of 4-8 ug/ml to stain Skeletal muscle cells (arrows) in Human Muscle. Magnification is at 400X
  • Western Blot analysis using FICD antibody (70R-5702) | FICD antibody (70R-5702) used at 0.25 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
View Our Distributors