FKBP11 antibody (70R-7231)

Rabbit polyclonal FKBP11 antibody raised against the N terminal of FKBP11

Synonyms Polyclonal FKBP11 antibody, Anti-FKBP11 antibody, FKBP19 antibody, FK506, FK 506 antibody, MGC54182 antibody, FK-506, Fk506 Binding Protein 11 19 Kda antibody, FK-506 antibody, FK 506
Specificity FKBP11 antibody was raised against the N terminal of FKBP11
Cross Reactivity Human,Mouse
Applications WB
Immunogen FKBP11 antibody was raised using the N terminal of FKBP11 corresponding to a region with amino acids VRTLQVETLVEPPEPCAEPAAFGDTLHIHYTGSLVDGRIIDTSLTRDPLV
Assay Information FKBP11 Blocking Peptide, catalog no. 33R-9792, is also available for use as a blocking control in assays to test for specificity of this FKBP11 antibody

Images

Western Blot analysis using FKBP11 antibody (70R-7231)

FKBP11 antibody (70R-7231) used at 1 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 19 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of FKBP11 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance FKBP11 belongs to the FKBP family of peptidyl-prolyl cis/trans isomerases, which catalyze the folding of proline-containing polypeptides. The peptidyl-prolyl isomerase activity of FKBP proteins is inhibited by the immunosuppressant compounds FK506 and rapamycin.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using FKBP11 antibody (70R-7231) | FKBP11 antibody (70R-7231) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
OR
Shipping
View Our Distributors