FKBP8 antibody (70R-5951)

Rabbit polyclonal FKBP8 antibody raised against the C terminal of FKBP8

Synonyms Polyclonal FKBP8 antibody, Anti-FKBP8 antibody, FKBPr38 antibody, FKBP38 antibody, FK 506 antibody, FK-506, Fk506 Binding Protein 8 38Kda antibody, FK-506 antibody, FK 506, FK506
Specificity FKBP8 antibody was raised against the C terminal of FKBP8
Cross Reactivity Human,Mouse,Rat
Applications WB
Immunogen FKBP8 antibody was raised using the C terminal of FKBP8 corresponding to a region with amino acids AIPILRAALKLEPSNKTIHAELSKLVKKHAAQRSTETALYRKMLGNPSRL
Assay Information FKBP8 Blocking Peptide, catalog no. 33R-1277, is also available for use as a blocking control in assays to test for specificity of this FKBP8 antibody


Western Blot analysis using FKBP8 antibody (70R-5951)

FKBP8 antibody (70R-5951) used at 1 ug/ml to detect target protein.


Host Rabbit
Method of Purification Affinity purified
Molecular Weight 45 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of FKBP8 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance FKBP8 is a member of the immunophilin protein family, which play a role in immunoregulation and basic cellular processes involving protein folding and trafficking. Unlike the other members of the family, it does not seem to have PPIase/rotamase activity. It may have a role in neurons associated with memory function.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Western Blot analysis using FKBP8 antibody (70R-5951) | FKBP8 antibody (70R-5951) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
View Our Distributors