FLAD1 antibody (70R-2167)

Rabbit polyclonal FLAD1 antibody

Synonyms Polyclonal FLAD1 antibody, Anti-FLAD1 antibody, RP11-307C12.7 antibody, FLAD-1 antibody, FLAD-1, FADS antibody, Fad1 Flavin Adenine Dinucleotide Synthetase Homolog antibody, FLAD1, PP591 antibody, MGC31803 antibody, FAD1 antibody, FLAD 1, MGC40255 antibody, FLAD 1 antibody
Cross Reactivity Human,Mouse,Rat
Applications WB
Immunogen FLAD1 antibody was raised using a synthetic peptide corresponding to a region with amino acids PGRSVTAGIIIVGDEILKGHTQDTNTFFLCRTLRSLGVQVCRVSVVPDEV
Assay Information FLAD1 Blocking Peptide, catalog no. 33R-7130, is also available for use as a blocking control in assays to test for specificity of this FLAD1 antibody

Images

Western Blot analysis using FLAD1 antibody (70R-2167)

FLAD1 antibody (70R-2167) used at 1 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 65 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of FLAD1 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance FLAD1 catalyzes the adenylation of flavin mononucleotide (FMN) to form flavin adenine dinucleotide (FAD) coenzyme.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using FLAD1 antibody (70R-2167) | FLAD1 antibody (70R-2167) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
OR
Shipping
View Our Distributors