FLII antibody (70R-2267)

Rabbit polyclonal FLII antibody

Synonyms Polyclonal FLII antibody, Anti-FLII antibody, Fli1 antibody, FLIL antibody, FLI antibody, MGC39265 antibody, Flightless I Homolog antibody
Cross Reactivity Human,Mouse,Rat
Applications WB
Immunogen FLII antibody was raised using a synthetic peptide corresponding to a region with amino acids LAEDILNTMFDTSYSKQVINEGEEPENFFWVGIGAQKPYDDDAEYMKHTR
Assay Information FLII Blocking Peptide, catalog no. 33R-4761, is also available for use as a blocking control in assays to test for specificity of this FLII antibody


Western Blot analysis using FLII antibody (70R-2267)

FLII antibody (70R-2267) used at 1 ug/ml to detect target protein.


Host Rabbit
Method of Purification Affinity purified
Molecular Weight 145 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of FLII antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance FLII is a protein with a gelsolin-like actin binding domain and an N-terminal leucine-rich repeat-protein protein interaction domain. The protein is similar to a Drosophila protein involved in early embryogenesis and the structural organization of indirect flight muscle. This gene is located within the Smith-Magenis syndrome region on chromosome 17.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Western Blot analysis using FLII antibody (70R-2267) | FLII antibody (70R-2267) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
View Our Distributors