FLJ10769 antibody (70R-7361)

Rabbit polyclonal FLJ10769 antibody raised against the middle region of Flj10769

Synonyms Polyclonal FLJ10769 antibody, Anti-FLJ10769 antibody, FLJ 10769, FLJ 10769 antibody, LP3298 antibody, FLJ-10769 antibody, FLJ10769, FLJ34548 antibody, FLJ-10769
Specificity FLJ10769 antibody was raised against the middle region of Flj10769
Cross Reactivity Human
Applications WB
Immunogen FLJ10769 antibody was raised using the middle region of Flj10769 corresponding to a region with amino acids ILSNGQQVLVCSQEGSSRRCGGQGDLLSGSLGVLVHWALLAGPQKTNGGI
Assay Information FLJ10769 Blocking Peptide, catalog no. 33R-4061, is also available for use as a blocking control in assays to test for specificity of this FLJ10769 antibody

Images

Western Blot analysis using FLJ10769 antibody (70R-7361)

FLJ10769 antibody (70R-7361) used at 1 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 41 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of FLJ10769 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance The function of FLJ10769 protein has not been widely studied, and is yet to be fully elucidated.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using FLJ10769 antibody (70R-7361) | FLJ10769 antibody (70R-7361) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
OR
Shipping
View Our Distributors