FLJ14803 antibody (70R-6988)

Rabbit polyclonal FLJ14803 antibody raised against the N terminal Of Flj14803

Synonyms Polyclonal FLJ14803 antibody, Anti-FLJ14803 antibody, FLJ 14803 antibody, FLJ14803, FLJ 14803, FLJ-14803 antibody, Hypothetical Protein FLJ14803 antibody, FLJ-14803
Specificity FLJ14803 antibody was raised against the N terminal Of Flj14803
Cross Reactivity Human
Applications WB
Immunogen FLJ14803 antibody was raised using the N terminal Of Flj14803 corresponding to a region with amino acids MMQGEAHPSASLIDRTIKMRKETEARKVVLAWGLLNVSMAGMIYTEMTGK
Assay Information FLJ14803 Blocking Peptide, catalog no. 33R-6235, is also available for use as a blocking control in assays to test for specificity of this FLJ14803 antibody

Images

Western Blot analysis using FLJ14803 antibody (70R-6988)

FLJ14803 antibody (70R-6988) used at 1 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 62 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of FLJ14803 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance The specific function of FLJ14803 is not yet known.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using FLJ14803 antibody (70R-6988) | FLJ14803 antibody (70R-6988) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
OR
Shipping
View Our Distributors