FLJ20433 antibody (70R-3418)

Rabbit polyclonal FLJ20433 antibody raised against the N terminal of FLJ20433

Synonyms Polyclonal FLJ20433 antibody, Anti-FLJ20433 antibody, FLJ 20433 antibody, Hypothetical Protein Flj20433 antibody, FLJ-20433, FLJ-20433 antibody, FLJ30442 antibody, FLJ 20433, MGC131904 antibody, MGC74981 antibody, FLJ20433
Specificity FLJ20433 antibody was raised against the N terminal of FLJ20433
Cross Reactivity Human
Applications WB
Immunogen FLJ20433 antibody was raised using the N terminal of FLJ20433 corresponding to a region with amino acids MGPAGCAFTLLLLLGISVCGQPVYSSRVVGGQDAAAGRWPWQVSLHFDHN
Assay Information FLJ20433 Blocking Peptide, catalog no. 33R-6053, is also available for use as a blocking control in assays to test for specificity of this FLJ20433 antibody


Western Blot analysis using FLJ20433 antibody (70R-3418)

FLJ20433 antibody (70R-3418) used at 1 ug/ml to detect target protein.


Host Rabbit
Method of Purification Affinity purified
Molecular Weight 83 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of FLJ20433 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance The specific function of FLJ20433 is not yet known.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Western Blot analysis using FLJ20433 antibody (70R-3418) | FLJ20433 antibody (70R-3418) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
View Our Distributors