FLJ20674 antibody (70R-7427)

Rabbit polyclonal FLJ20674 antibody raised against the N terminal of FLJ20674

Synonyms Polyclonal FLJ20674 antibody, Anti-FLJ20674 antibody, FLJ-20674, FLJ 20674 antibody, FLJ-20674 antibody, FLJ20674, FLJ 20674, Hypothetical Protein Flj20674 antibody
Specificity FLJ20674 antibody was raised against the N terminal of FLJ20674
Cross Reactivity Human,Mouse,Rat
Applications WB
Immunogen FLJ20674 antibody was raised using the N terminal of FLJ20674 corresponding to a region with amino acids LNVTQWFQVWLQVASGPYQIEVHIVATGTLPNGTLYAARGSQVDFSCNSS
Assay Information FLJ20674 Blocking Peptide, catalog no. 33R-5254, is also available for use as a blocking control in assays to test for specificity of this FLJ20674 antibody

Images

Western Blot analysis using FLJ20674 antibody (70R-7427)

FLJ20674 antibody (70R-7427) used at 1 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 59 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of FLJ20674 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance The function of FLJ20674 protein is not widely studied, and is yet to be elucidated fully.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using FLJ20674 antibody (70R-7427) | FLJ20674 antibody (70R-7427) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
OR
Shipping
View Our Distributors