FLJ23356 antibody (70R-6601)

Rabbit polyclonal FLJ23356 antibody raised against the N terminal of FLJ23356

Synonyms Polyclonal FLJ23356 antibody, Anti-FLJ23356 antibody, FLJ 23356, FLJ23356, Hypothetical Protein Flj23356 antibody, FLJ 23356 antibody, MGC126597 antibody, FLJ-23356, FLJ-23356 antibody
Specificity FLJ23356 antibody was raised against the N terminal of FLJ23356
Cross Reactivity Human,Mouse
Applications WB
Immunogen FLJ23356 antibody was raised using the N terminal of FLJ23356 corresponding to a region with amino acids CEELRTEVRQLKRVGEGAVKRVFLSEWKEHKVALSQLTSLEMKDDFLHGL
Assay Information FLJ23356 Blocking Peptide, catalog no. 33R-1673, is also available for use as a blocking control in assays to test for specificity of this FLJ23356 antibody

Images

Western Blot analysis using FLJ23356 antibody (70R-6601)

FLJ23356 antibody (70R-6601) used at 1 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 40 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of FLJ23356 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance The function of FLJ23356 protein has not been widely studied, and is yet to be fully elucidated.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using FLJ23356 antibody (70R-6601) | FLJ23356 antibody (70R-6601) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
OR
Shipping
View Our Distributors